DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and C1R

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens


Alignment Length:300 Identity:84/300 - (28%)
Similarity:123/300 - (41%) Gaps:59/300 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LPRTTP---RPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGAS 165
            :||..|   :|.:.::|..           |::||....:..|||..........||       :
Human   458 IPRCLPVCGKPVNPVEQRQ-----------RIIGGQKAKMGNFPWQVFTNIHGRGGG-------A 504

  Fly   166 FIAQRWLLTAAHCI----HTMGRNLTAAI-LGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRIL 225
            .:..||:|||||.:    |....|.:..: ||..|.:......|.              .|.|:.
Human   505 LLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNH--------------PIRRVS 555

  Fly   226 PHAQYSE---LNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTES 287
            .|..|.:   .|:..|||||.|...|.  ...||.|:|||.....|...|.|.   |||:|..|.
Human   556 VHPDYRQDESYNFEGDIALLELENSVT--LGPNLLPICLPDNDTFYDLGLMGY---VSGFGVMEE 615

  Fly   288 SGSSKIKQKAMLHIQPQDQCQEAFY-KDTKITLADSQMCAG-GEIGVDSCSGDSGGPLTV-EANT 349
            ..:..::...:....|| .|:.... |:.....:.:..||| ..:..|:|.|||||...| :.||
Human   616 KIAHDLRFVRLPVANPQ-ACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNT 679

  Fly   350 ASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIE 389
               :|:| ..|:||.|   .|.:...|.||:|.:|:|||:
Human   680 ---DRWV-ATGIVSWG---IGCSRGYGFYTKVLNYVDWIK 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 77/267 (29%)
Tryp_SPc 133..391 CDD:238113 78/267 (29%)
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839
Sushi 323..385 CDD:306569
Sushi 390..461 CDD:306569 1/2 (50%)
Tryp_SPc 477..711 CDD:214473 77/267 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.