DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and TMPRSS2

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001128571.1 Gene:TMPRSS2 / 7113 HGNCID:11876 Length:529 Species:Homo sapiens


Alignment Length:295 Identity:89/295 - (30%)
Similarity:127/295 - (43%) Gaps:70/295 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CG----SAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGR 184
            ||    |:...|:|||.:.....:||...|..:.|     :.||.|.|...|::|||||:     
Human   281 CGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNV-----HVCGGSIITPEWIVTAAHCV----- 335

  Fly   185 NLTAAILGEWNRDTDPDCENDLNGVRECAPPH-------IRVT---------IDRILPHAQYSEL 233
                              |..||.     |.|       :|.:         :::::.|..|...
Human   336 ------------------EKPLNN-----PWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSK 377

  Fly   234 NYRNDIALLRLSRPVNWLQMQNLEPVCLP-PQRGRYANQLAGSAADVSGWGKTESSG-SSKIKQK 296
            ...|||||::|.:|:.:..:  ::||||| |.......||..    :||||.||..| :|::...
Human   378 TKNNDIALMKLQKPLTFNDL--VKPVCLPNPGMMLQPEQLCW----ISGWGATEEKGKTSEVLNA 436

  Fly   297 AMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIG-VDSCSGDSGGPLTVEANTASGNRYVYLAG 360
            |.:.:....:|...:..|..||.|  .:|||...| ||||.|||||||     ..|.|...:|.|
Human   437 AKVLLIETQRCNSRYVYDNLITPA--MICAGFLQGNVDSCQGDSGGPL-----VTSKNNIWWLIG 494

  Fly   361 VVSIGRKHCGTALFSGIYTRVSSYMDWIESTIRAN 395
            ..|.| ..|..|...|:|..|..:.|||...:||:
Human   495 DTSWG-SGCAKAYRPGVYGNVMVFTDWIYRQMRAD 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 82/275 (30%)
Tryp_SPc 133..391 CDD:238113 83/276 (30%)
TMPRSS2NP_001128571.1 DUF3824 <44..91 CDD:289625
LDLa 150..185 CDD:238060
SRCR_2 190..283 CDD:292133 1/1 (100%)
Tryp_SPc 292..521 CDD:214473 82/275 (30%)
Tryp_SPc 293..524 CDD:238113 83/277 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.