DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Prss41

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:345 Identity:97/345 - (28%)
Similarity:144/345 - (41%) Gaps:94/345 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PPLAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCG--SAFSFRLVGGHNTGLFEF 143
            |.|.|.....:..|...:|.:|||            .:|    ||  :....|:|||..:....:
Mouse    47 PYLHPGSREESQAADLKSTDIKLL------------SMP----CGRRNDTRSRIVGGIESMQGRW 95

  Fly   144 PWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHT-MGRNLTAAILGE-------WNRDTDP 200
            ||...|..:     |.:.||.|.:::||:||||||... :........||:       |||..  
Mouse    96 PWQASLRLK-----KSHRCGGSLLSRRWVLTAAHCFRKYLDPEKWTVQLGQLTSKPSYWNRKA-- 153

  Fly   201 DCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQR 265
                 .:|         |..:..|:.::: .:|. .:|:|||||:..|.:  .::::|||:.|..
Mouse   154 -----YSG---------RYRVKDIIVNSE-DKLK-SHDLALLRLASSVTY--NKDIQPVCVQPST 200

  Fly   266 GRYANQLAGSAADVSGWGKTESSGSSKIK--------QKAMLHIQPQDQCQEAF---------YK 313
            ....:|   ....|:|||..:..    :|        ::..:.|....:|||.|         .|
Mouse   201 FTSQHQ---PRCWVTGWGVLQED----LKPLPPPYHLREVQVSILNNSRCQELFEIFSLHHLITK 258

  Fly   314 DTKITLADSQMCAGGEIG-VDSCSGDSGGPLTVEANTASGNRYVYLAGVVS--IGRKHCGTALFS 375
            |.        .|||.|.| .|:|||||||||     ..:.:...|..|:||  ||   ||.....
Mouse   259 DV--------FCAGAEDGSADTCSGDSGGPL-----VCNMDGLWYQIGIVSWGIG---CGRPNLP 307

  Fly   376 GIYTRVSSYMDWIESTIRAN 395
            ||||.||.|.:|||:.:..|
Mouse   308 GIYTNVSHYYNWIETMMILN 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 82/284 (29%)
Tryp_SPc 133..391 CDD:238113 84/285 (29%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 82/284 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.