DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Prss56

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_006529921.1 Gene:Prss56 / 69453 MGIID:1916703 Length:605 Species:Mus musculus


Alignment Length:355 Identity:102/355 - (28%)
Similarity:146/355 - (41%) Gaps:77/355 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PLAPRISNGTTNATSS--TTTLKLLPRTT------------------------PRPPSGIDQLPE 120
            ||..|:|.|.....|:  |..|:...|:.                        |||.:.:.|.|.
Mouse    24 PLYTRLSPGALQVLSAQGTQALQAAQRSAQWAIKRVLMEIQHRLHECQVGPGRPRPQAPLLQDPP 88

  Fly   121 HP-YCGSAFS---------FRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTA 175
            .| .||....         .|:|||.......:||...|:.    ||.. .||...:|..|:|||
Mouse    89 EPVQCGERHQGVANTTRAHGRIVGGSTAPSGAWPWLVRLQL----GGLP-LCGGVLVAASWVLTA 148

  Fly   176 AHCIHTMGRNLT-AAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDI 239
            |||.......|. ..:|.|..:....:                .|.::|||||.::....:.||:
Mouse   149 AHCFAGASNELLWTVMLAEGPQGEQAE----------------EVQVNRILPHPKFDPQTFHNDL 197

  Fly   240 ALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKT-ESSGSSKIKQKAMLHIQP 303
            ||::|..||:  ......|:|| ||..|  ...||:...::|||.. |....|:..::|.:.:..
Mouse   198 ALVQLWTPVS--PEGPARPICL-PQGSR--EPPAGTPCAIAGWGALFEDGPESEAVREARVPLLS 257

  Fly   304 QDQCQEAFYKDTKITLADSQMCAG---GEIGVDSCSGDSGGPLTVEANTASGNR-YVYLAGVVSI 364
            .|.||:......:   ..:.:|||   |  |:|||.||||||||.   :..|.| ...|.||.|.
Mouse   258 ADTCQKVLGPGLR---PSTMLCAGYLAG--GIDSCQGDSGGPLTC---SEPGPRPREVLFGVTSW 314

  Fly   365 GRKHCGTALFSGIYTRVSSYMDWIESTIRA 394
            | ..||.....|:||||:.:.||::..:.|
Mouse   315 G-DGCGEPGKPGVYTRVTVFKDWLQEQMSA 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 83/262 (32%)
Tryp_SPc 133..391 CDD:238113 83/263 (32%)
Prss56XP_006529921.1 Tryp_SPc 109..336 CDD:214473 82/261 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.