DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Prss55

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_008769022.1 Gene:Prss55 / 683415 RGDID:1586875 Length:321 Species:Rattus norvegicus


Alignment Length:266 Identity:79/266 - (29%)
Similarity:122/266 - (45%) Gaps:44/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTM---GRNLTAAILG 192
            |::||....:.||||..     ::.....:.||.|.:::.|:||.|||.::.   ...||..:  
  Rat    34 RIIGGQEAEVGEFPWQV-----SIQENDHHFCGGSILSEWWILTVAHCFYSQELSPTELTVRV-- 91

  Fly   193 EWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLE 257
                     ..|||.    .:|..::||  .|:.|..:...:..||||||.|:.|:.:  .:...
  Rat    92 ---------GTNDLT----TSPMELQVT--NIIRHKDFKRHSMDNDIALLLLANPLTF--NEQTV 139

  Fly   258 PVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIK---QKAMLHIQPQDQCQEAFYKDTKITL 319
            |:|:|.|    ....:.....|:|||.|.|:....:.   .|..:.|....:|.:.|     .:|
  Rat   140 PICMPLQ----PTPPSWQECWVAGWGTTNSADKESMNMDLMKVPMRITDWKECLQLF-----PSL 195

  Fly   320 ADSQMCAG-GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSS 383
            ..:.:||. |....|:|.|||||||.  .|..|..|: |..|::|.| |.||.....||||.:::
  Rat   196 TTNMLCASYGNESFDACQGDSGGPLV--CNQESDGRW-YQVGIISWG-KSCGQKGSPGIYTVLAN 256

  Fly   384 YMDWIE 389
            |:.|||
  Rat   257 YILWIE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 76/263 (29%)
Tryp_SPc 133..391 CDD:238113 78/264 (30%)
Prss55XP_008769022.1 Tryp_SPc 35..264 CDD:238113 78/265 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.