DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Prss41

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001128559.1 Gene:Prss41 / 681033 RGDID:1584711 Length:324 Species:Rattus norvegicus


Alignment Length:320 Identity:92/320 - (28%)
Similarity:139/320 - (43%) Gaps:80/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TTLKLLPRTTPRPPSGIDQLPEHPYCG--SAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYA 161
            |.:|||            .:|    ||  :....|:|||..:....:||...|...     |.:.
  Rat    36 TDIKLL------------SMP----CGRRNDIRSRIVGGIESVRGRWPWQASLRLR-----KFHR 79

  Fly   162 CGASFIAQRWLLTAAHCIHT-MGRNLTAAILGE-------WNRDTDPDCENDLNGVRECAPPHIR 218
            ||.|.::.||:||||||... :........||:       |||:.       .:|         |
  Rat    80 CGGSLLSHRWVLTAAHCFRKFLDPKKWTVQLGQLTSKPSFWNREA-------FSG---------R 128

  Fly   219 VTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWG 283
            ..:..|:.::: .:|.| :|:|||||:..|.:.:.  ::|||:.|......:|   ....|:|||
  Rat   129 YRVKDIIINSE-DKLKY-HDLALLRLASSVTYNKF--IQPVCVLPSASMSQHQ---PRCWVTGWG 186

  Fly   284 KTESSGSSKIK-----------QKAMLHIQPQDQCQEAFYKDTKITLADSQM-CAGGEIG-VDSC 335
            ..:..    :|           |..:|::   .:|||.|...::..|....: |||.|.| .|:|
  Rat   187 ALQED----LKPLPPPYHLREVQVTVLNL---SRCQELFSFASRYHLITRDVFCAGAEDGSADTC 244

  Fly   336 SGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIRAN 395
            ||||||||     ..:.:...|..|:||.| ..||.....||||.||.:.|||::.:..|
  Rat   245 SGDSGGPL-----VCNMDGLWYQIGIVSRG-VGCGRPKLPGIYTNVSHHYDWIKTMMILN 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 82/277 (30%)
Tryp_SPc 133..391 CDD:238113 83/278 (30%)
Prss41NP_001128559.1 Tryp_SPc 54..291 CDD:214473 82/277 (30%)
Tryp_SPc 55..292 CDD:238113 82/277 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.