DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and f9b

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001035400.1 Gene:f9b / 678552 ZFINID:ZDB-GENE-060421-7346 Length:507 Species:Danio rerio


Alignment Length:321 Identity:97/321 - (30%)
Similarity:148/321 - (46%) Gaps:51/321 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 NGTT-NATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFS-----FRLVGGHNTGLFEFPWTT 147
            |||. |.|.|:.|......:|..|.:.:..:...|...:..:     :|:|||......|.||..
Zfish   207 NGTEYNTTESSPTDLSEMNSTSTPRNSLQNVSSSPILTNINNTTNNKYRIVGGDEAIPGEIPWQV 271

  Fly   148 LLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAI-LGEWNRDTDPDCENDLNGVRE 211
            :. .|.|:  |...||.|.:::.|::|||||:.  |:..:..| :||.:.......|:| :|:.|
Zfish   272 VF-LEKVN--KIVFCGGSLLSEEWVITAAHCVE--GKQGSFFIRVGEHDVSKMEGTESD-HGIEE 330

  Fly   212 CAPPHIRVTIDRILPHAQYSELN--YRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAG 274
            .   ||         |.:|:...  |.:|||||:|.:||  :......|:||..:  .:...|..
Zfish   331 Y---HI---------HPRYNSQRSLYNHDIALLKLKKPV--ILFDYAVPICLGSK--DFTENLLQ 379

  Fly   275 SAAD--VSGWGKTESSG-SSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAG-GEIGVDSC 335
            ||.:  |||||:....| .|.:.||..|....:.:|:.:    :..:::....||| ..:..|:|
Zfish   380 SAENSLVSGWGRLRYGGIESNVLQKVELPYVDRIKCKGS----STDSISRFMFCAGYSTVRKDAC 440

  Fly   336 SGDSGGPLTVEANTASGNRYV---YLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIR 393
            .||||||        ...||.   :|.|:||.| :.|......|||||:|.||.||.:..|
Zfish   441 QGDSGGP--------HATRYKDTWFLTGIVSWG-EECAKEGKYGIYTRISKYMAWITNITR 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 84/266 (32%)
Tryp_SPc 133..391 CDD:238113 85/267 (32%)
f9bNP_001035400.1 GLA 23..86 CDD:214503
EGF_CA 88..124 CDD:238011
FXa_inhibition 131..167 CDD:291342
Tryp_SPc 255..487 CDD:214473 84/266 (32%)
Tryp_SPc 256..490 CDD:238113 85/268 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.