DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:278 Identity:85/278 - (30%)
Similarity:121/278 - (43%) Gaps:67/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWN 195
            ::|||:.......|:...|.    ||  .:.||.|.|..:|:::||||.    ::.....|||.|
Mouse    24 KIVGGYTCQRNALPYQVSLN----SG--YHFCGGSLINSQWVVSAAHCY----KSRIQVRLGEHN 78

  Fly   196 RDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRL--SRPVNWLQMQNLEP 258
            .|.       |.|..:.      :...:|:.|..|:...|.|||.|::|  :..:|    ..:..
Mouse    79 IDA-------LEGGEQF------IDAAKIIRHPNYNANTYNNDIMLIKLKTAATLN----SRVST 126

  Fly   259 VCLP---PQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEA-FYKDTKIT- 318
            |.||   |.        ||:...|||||.|.|||::   ..::|      ||.:| ...|:..| 
Mouse   127 VALPRSCPS--------AGTRCLVSGWGNTLSSGTN---YPSLL------QCLDAPVLSDSSCTS 174

  Fly   319 -----LADSQMCAGG-EIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGI 377
                 :..:..|.|. |.|.|||.||||||:.....         |.||||.| ..|......|:
Mouse   175 SYPGKITSNMFCLGFLEGGKDSCQGDSGGPVVCNGQ---------LQGVVSWG-YGCAQRGKPGV 229

  Fly   378 YTRVSSYMDWIESTIRAN 395
            ||:|..|::||:.||.||
Mouse   230 YTKVCKYVNWIQQTIAAN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 79/269 (29%)
Tryp_SPc 133..391 CDD:238113 81/270 (30%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 79/269 (29%)
Tryp_SPc 25..243 CDD:238113 81/271 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.