DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and zgc:123295

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:274 Identity:89/274 - (32%)
Similarity:137/274 - (50%) Gaps:39/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSA-FSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIH-TMGRNL 186
            ||.| .:.::|||.|.|...:||...|:..|..|   :.||.|.|.:.|:|:||||.. ::|..:
Zfish    27 CGRAPLNTKIVGGQNAGAGSWPWQVSLQSPTYGG---HFCGGSLINKDWVLSAAHCFQDSIGTIM 88

  Fly   187 TAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWL 251
            ..  ||             |.......|..|..|:.:::.|..|:..:..|||||::|...|.: 
Zfish    89 VK--LG-------------LQSQSGSNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTF- 137

  Fly   252 QMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSS--KIKQKAMLHIQPQDQCQEAFYKD 314
             ...:|||||......||   ||:.:.|:||||..|:.:.  .|.|:..:.|.....|:.|:..:
Zfish   138 -NDYIEPVCLAAAGNTYA---AGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDCKRAYPGE 198

  Fly   315 TKITLADSQMCAG--GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGI 377
                :..:.:|||  .:.|.|||.||||||:.    :.:|::::. :|:||.|| .|....:.|:
Zfish   199 ----ITSNMICAGLLDQGGKDSCQGDSGGPMV----SRNGSQWIQ-SGIVSFGR-GCAEPGYPGV 253

  Fly   378 YTRVSSYMDWIEST 391
            |.|||.|.|||.|:
Zfish   254 YARVSQYQDWITSS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 83/261 (32%)
Tryp_SPc 133..391 CDD:238113 85/262 (32%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 83/261 (32%)
Tryp_SPc 36..264 CDD:238113 83/260 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.