DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and zgc:123217

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:279 Identity:73/279 - (26%)
Similarity:126/279 - (45%) Gaps:32/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSA-FSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLT 187
            ||.| .:.|:|||.:.....:||...:.|     ...:.||.:.|..:|::||||||.....|:.
Zfish    28 CGVAPLNTRIVGGTDAPAGSWPWQVSIHY-----NNRHICGGTLIHSQWVMTAAHCIINTNINVW 87

  Fly   188 AAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQ 252
            ...||...:.|.           ...|..::|.|..|:.|..::.....|||:|::||:|||:  
Zfish    88 TLYLGRQTQSTS-----------VANPNEVKVGIQSIIDHPSFNNSLLNNDISLMKLSQPVNF-- 139

  Fly   253 MQNLEPVCLPPQRGRYANQLAGSAADVSGW---GKTESSGSSKIKQKAMLHIQPQDQCQEAFYKD 314
            ...:.|:||......:.|   |::...:||   ||.::..:.:..|:..:.:.....|...:...
Zfish   140 SLYIRPICLAANNSIFYN---GTSCWATGWGNIGKDQALPAPQTLQQVQIPVVANSLCSTEYESV 201

  Fly   315 TKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRK-HCGTALFSGIY 378
            ...|:....:|| |:....:|.||||||...:    .|:.::. ||:.|.|.. .|....:..:|
Zfish   202 NNATITPQMICA-GKANKGTCQGDSGGPFQCK----QGSVWIQ-AGITSYGTSAGCAVGAYPDVY 260

  Fly   379 TRVSSYMDWIESTIRANRI 397
            :|||.:..||:..::.:.|
Zfish   261 SRVSEFQSWIKMNVQGSAI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 67/260 (26%)
Tryp_SPc 133..391 CDD:238113 68/261 (26%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 67/260 (26%)
Tryp_SPc 37..273 CDD:238113 68/262 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.