DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CELA2A

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_254275.1 Gene:CELA2A / 63036 HGNCID:24609 Length:269 Species:Homo sapiens


Alignment Length:296 Identity:93/296 - (31%)
Similarity:142/296 - (47%) Gaps:65/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDY-ACGASFIAQRWLLTAAHCIHT- 181
            |.:|    .:..|:|||.......:||...|:|.  |.||.| .||.|.||..|:|||||||.: 
Human    20 PTYP----PYVTRVVGGEEARPNSWPWQVSLQYS--SNGKWYHTCGGSLIANSWVLTAAHCISSS 78

  Fly   182 ------MGR-NLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQY--SELNYRN 237
                  :|| ||..|..|.                       :.|::.:|:.|..:  ::::..|
Human    79 RTYRVGLGRHNLYVAESGS-----------------------LAVSVSKIVVHKDWNSNQISKGN 120

  Fly   238 DIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAAD------VSGWGKTESSGS-SKIKQ 295
            |||||:|:.||:  ....::..||||         ||:...      |:|||:.:::|: ..:.|
Human   121 DIALLKLANPVS--LTDKIQLACLPP---------AGTILPNNYPCYVTGWGRLQTNGAVPDVLQ 174

  Fly   296 KAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAG 360
            :..|.:.....|..:.:..:.:  ..|.:||||:..:.||:|||||||..:|  :.|...|:  |
Human   175 QGRLLVVDYATCSSSAWWGSSV--KTSMICAGGDGVISSCNGDSGGPLNCQA--SDGRWQVH--G 233

  Fly   361 VVSIG-RKHCGTALFSGIYTRVSSYMDWIESTIRAN 395
            :||.| |..|.......::||||:|:|||.|.|..|
Human   234 IVSFGSRLGCNYYHKPSVFTRVSNYIDWINSVIANN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 86/275 (31%)
Tryp_SPc 133..391 CDD:238113 87/276 (32%)
CELA2ANP_254275.1 Tryp_SPc 29..265 CDD:238113 87/277 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.