DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG17239

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:280 Identity:82/280 - (29%)
Similarity:122/280 - (43%) Gaps:79/280 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPW-TTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEW 194
            |:|||....:...|| .::|..     |: :.|||:..::..::|||||:               
  Fly    23 RIVGGDLITILSVPWQASILRL-----GR-FHCGAAIYSEDIVITAAHCL--------------- 66

  Fly   195 NRDTDPDCENDLNGVRECAPPHIR------------VTIDRILPHAQYSELNYRNDIALLRLSRP 247
               ||          ||.....:|            |.:..:|.|.:|.: ::.||||::||...
  Fly    67 ---TD----------RETEFLSVRVGSSFTFFGGQVVRVSSVLLHEEYDQ-SWSNDIAVMRLQSK 117

  Fly   248 VNWLQMQNLEPVC-LPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAML----HIQPQDQC 307
            :......::.|:. .||        .:||.|.|||||   :.|..|....::|    .|..||||
  Fly   118 LRLGSAVSVIPLADTPP--------ASGSPATVSGWG---AIGFKKNYPMSILSASVDIVDQDQC 171

  Fly   308 QEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTA 372
            :.::.:  |||  ...:||... |.|:|||||||||      .|||:   |.|:||.| |.|...
  Fly   172 RRSYGR--KIT--KDMICAAAP-GKDACSGDSGGPL------VSGNK---LVGIVSFG-KECAHP 221

  Fly   373 LFSGIYTRVSSYMDWIESTI 392
            .:.|:|..|:....||...|
  Fly   222 EYPGVYANVAELKPWILGAI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 79/274 (29%)
Tryp_SPc 133..391 CDD:238113 80/275 (29%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 79/274 (29%)
Tryp_SPc 24..237 CDD:238113 78/273 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.