DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG18754

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:378 Identity:110/378 - (29%)
Similarity:163/378 - (43%) Gaps:93/378 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DKLMELASKQQCFSRQR-PDLVCCPRETNIIPPLAPRISNGTTNATSSTTTLKLLPRTTPRPPSG 114
            ::|.|......|...:: ..||.|....||:.|      .|.|.|....    ...|.....|:|
  Fly    19 NQLAECVRLSSCQKDEKCTRLVSCSPLMNILRP------RGMTQAEKDV----FAHRQCGLDPNG 73

  Fly   115 I--------------DQLPEHPYCGSAFS-FRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGA 164
            .              |.||....||.... ||..|..|..|.|:||..||.||.         ..
  Fly    74 HELLHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYEN---------RL 129

  Fly   165 SFIAQRWLLTAAHCIHTMGRNLT-------AAILGEWNRDTDPDCENDLNGVRECAPPHIRVTID 222
            |.|  |::||||||:  :|..||       :..|||    :..||   :.....|  ||:.|.:.
  Fly   130 SLI--RYVLTAAHCV--IGGYLTQNDLVLKSVRLGE----STTDC---ITSESRC--PHLDVEVG 181

  Fly   223 RILPHAQYSEL--NYRNDIALLRLSRPVNWLQMQNLEPVCL-----PPQRGRYANQLAGSAADVS 280
            :...|..::..  .||||||||||..||.:  .:.::|:||     |         |......:|
  Fly   182 QTTVHQGFTSSGGTYRNDIALLRLQFPVRY--TKKIQPICLLDAEFP---------LQDLNLQIS 235

  Fly   281 GWGKTESSG---SSKIKQKAMLHIQPQDQCQEAF--YKDTKITLADSQMCAGGEIGVDSCSGDSG 340
            ||..|:||.   :|.:|::     .|.| |...:  ::..      ||:||||:...|:|:|.||
  Fly   236 GWDPTKSSQTLITSTVKER-----NPAD-CLNRYPSFRSA------SQVCAGGQRKGDTCAGISG 288

  Fly   341 GPLTVEANTASG-NRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTI 392
            .|  |.....|| :.:|:|||:.|.|:::|.:|...|:||::..:.:||::.:
  Fly   289 SP--VMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 5/23 (22%)
Tryp_SPc 131..388 CDD:214473 87/276 (32%)
Tryp_SPc 133..391 CDD:238113 88/277 (32%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 12/58 (21%)
Tryp_SPc 108..338 CDD:238113 88/276 (32%)
Tryp_SPc 108..335 CDD:214473 86/273 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.