DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG18735

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:277 Identity:100/277 - (36%)
Similarity:144/277 - (51%) Gaps:41/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSAFS-FRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLT 187
            ||:..: .|:|||..|.:.|:||..:|.:    .|..| ||||.:..::.||||||::.....|.
  Fly    74 CGNINTRHRIVGGQETEVHEYPWMIMLMW----FGNFY-CGASLVNDQYALTAAHCVNGFYHRLI 133

  Fly   188 AAILGEWNRDTDPDCENDLNGVRECAPPHIRVT---IDRILPHAQYSELNYRNDIALLRLSRPVN 249
            ...|.|.||...                |:::.   :.|:|.|.:||..|:.:||||:|.:.||.
  Fly   134 TVRLLEHNRQDS----------------HVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVR 182

  Fly   250 WLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGS-SKIKQKAMLHIQPQDQCQEAFYK 313
             |.: ::.|||:|.....|    ||..|.|:|||.....|. |...|:..:.|..|::|:.:.|.
  Fly   183 -LGI-DMHPVCMPTPSENY----AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYG 241

  Fly   314 DTKITLADSQMCAG--GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSG 376
            ::|||  |:.:|||  .:.|.|||.||||||:.|   ..||:.| .|||:||.| :.|......|
  Fly   242 ESKIT--DNMICAGYVEQGGKDSCQGDSGGPMHV---LGSGDAY-QLAGIVSWG-EGCAKPNAPG 299

  Fly   377 IYTRVSSYMDWIESTIR 393
            :||||.|:.|||....|
  Fly   300 VYTRVGSFNDWIAENTR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 95/262 (36%)
Tryp_SPc 133..391 CDD:238113 96/263 (37%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 95/262 (36%)
Tryp_SPc 83..314 CDD:238113 96/264 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.