DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG34290

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:299 Identity:81/299 - (27%)
Similarity:118/299 - (39%) Gaps:84/299 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SAFSFRLVGGH-----NTGLFEFPWTTLLE---YETVSGGKDYA--CGASFIAQRWLLTAAHCIH 180
            |..:..:|||.     .:...::|:...|:   ....:.|..|.  ||.|.|:.||:|:||||:.
  Fly    28 SCHAVPIVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCVW 92

  Fly   181 TMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHA-------QYSELNYRND 238
            ....:..||.:|..|      .||                |.::.|:.       .:...|:|||
  Fly    93 RKNIHYIAAFIGYEN------IEN----------------IGQLQPYGLESVEYIYFQPSNFRND 135

  Fly   239 IALLRLSRPVNWLQMQN-LEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQ 302
            ||||.:.|.. |....| |:...||| .|...:|  ..:..:.|:|.|..:|             
  Fly   136 IALLYMKRRY-WSDFGNGLQYAQLPP-HGMKPDQ--NESCRIIGYGATHHAG------------- 183

  Fly   303 PQDQCQEAFYKDTKITLADSQMCAG--GEI---------------GVDSCSGDSGGPLTVEANTA 350
               .||:..: :.::.:.|:|.|..  |.|               ..|||.|||||||..   |.
  Fly   184 ---PCQKRLF-EAEVRVIDNQKCRDIIGHIWAPQNGANTVCALGNNQDSCQGDSGGPLIC---TY 241

  Fly   351 SGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIE 389
            .|..|:|  |:||.|.. ||......|||....|.||::
  Fly   242 GGKDYIY--GLVSHGLT-CGIPGMPSIYTVTRPYYDWVQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 79/291 (27%)
Tryp_SPc 133..391 CDD:238113 80/292 (27%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 80/291 (27%)
Tryp_SPc 34..276 CDD:214473 79/290 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455963
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.