DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and tmprss5

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:392 Identity:103/392 - (26%)
Similarity:165/392 - (42%) Gaps:90/392 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FY---AVDKLMEL-ASKQQ-----CFSRQRPD---LVCCPRETNI----------IPPLAPRISN 89
            ||   |.:.|:|: ..|.|     ||.|....   |||  |:...          :..:.|..::
Zfish   205 FYRISAENSLLEIQLEKLQTWLPVCFERWNSSLGTLVC--RQLGYLRLSKHKGVNLTDIGPNYTD 267

  Fly    90 GTTNATSS-TTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSF-RLVGGHNTGLFEFPWTTLLEYE 152
            |....||. .:.|:.|.|......:|.....:...||:.... |::||....|..:||...|.| 
Zfish   268 GFVQITSEYQSNLESLWRFRGSCSTGKVIALKCFECGTRAKLPRIIGGVEAALGRWPWQVSLYY- 331

  Fly   153 TVSGGKDYACGASFIAQRWLLTAAHCIHT---------------MGRNLTAAILGEWNRDTDPDC 202
                ...:.||.|.|..:|::|||||:|.               :..||  |.|.::.       
Zfish   332 ----NNRHICGGSIITNQWIVTAAHCVHNYRLPQVPSWVVYAGIITSNL--AKLAQYQ------- 383

  Fly   203 ENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGR 267
                           ...::||:.:..|:...:.|||||::|..|:|:  ...:.|||||    :
Zfish   384 ---------------GFAVERIIYNKNYNHRTHDNDIALVKLKTPLNF--SDTIRPVCLP----Q 427

  Fly   268 YANQL-AGSAADVSGWGKTESSG--SSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGE 329
            |.:.| .|:...:||||.|:...  ..::.::|.:.:....:|..:...:.:||  ...:|||..
Zfish   428 YDHDLPGGTQCWISGWGYTQPDDVLIPEVLKEAPVPLISTKKCNSSCMYNGEIT--SRMLCAGYS 490

  Fly   330 IG-VDSCSGDSGGPLTVEANTASGNRYVY-LAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTI 392
            .| ||:|.|||||||..:      :..|: |.||||.| ..|......|:|::|:.::.||...|
Zfish   491 EGKVDACQGDSGGPLVCQ------DENVWRLVGVVSWG-TGCAEPNHPGVYSKVAEFLGWIYDII 548

  Fly   393 RA 394
            .:
Zfish   549 ES 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 13/38 (34%)
Tryp_SPc 131..388 CDD:214473 76/276 (28%)
Tryp_SPc 133..391 CDD:238113 77/277 (28%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133 21/96 (22%)
Tryp_SPc 311..544 CDD:214473 76/276 (28%)
Tryp_SPc 312..547 CDD:238113 77/278 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.