DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP012035

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_001689264.1 Gene:AgaP_AGAP012035 / 5668016 VectorBaseID:AGAP012035 Length:197 Species:Anopheles gambiae


Alignment Length:128 Identity:30/128 - (23%)
Similarity:46/128 - (35%) Gaps:41/128 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLTLLGAEAQQFGKAIMHFGNCNSVEFGRGTCIEKKDCDFYAVDKLMELASKQQCFSRQRPD-- 69
            |.|.|:|.   .||:..::.. |.......|.||...:|     .|::||.::...:|.:...  
Mosquito    21 LMLFLVGV---AFGQRRVNQA-CILANGSSGRCIRIGEC-----SKIVELTTRNVLYSWETQQIR 76

  Fly    70 ---------------LVCC------PRETNIIPPLAPRISNGTTNATSSTTTLKLLPRTTPRP 111
                           :|||      |....:...:||     ||...:|||.:    .||.||
Mosquito    77 AVLRACESDESSSDPIVCCESAQSTPTRRTLNSGVAP-----TTTTAASTTPI----ATTRRP 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 12/67 (18%)
Tryp_SPc 131..388 CDD:214473
Tryp_SPc 133..391 CDD:238113
AgaP_AGAP012035XP_001689264.1 CLIP 39..95 CDD:288855 10/60 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.