DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP011918

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_001689276.1 Gene:AgaP_AGAP011918 / 5667954 VectorBaseID:AGAP011918 Length:259 Species:Anopheles gambiae


Alignment Length:271 Identity:74/271 - (27%)
Similarity:109/271 - (40%) Gaps:62/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRN---------- 185
            |:|.|.|....:||:...|    .|....:.||.:.|...|:||||||:  .||.          
Mosquito    31 RIVNGLNAVSGQFPYQVSL----TSATYQHFCGGAIIGNHWILTAAHCL--TGRKPAEVIAVVGA 89

  Fly   186 LTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNW 250
            ||:| .|.:|.|                       :::.:.|..::|...:|||||:|....:::
Mosquito    90 LTSA-RGGYNYD-----------------------VEQFILHPNFNEWTQQNDIALVRTKWSISF 130

  Fly   251 LQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESS---GSSKIKQKAMLHIQPQDQCQEAFY 312
                  .....|.:..|.... |..|...||||.|..|   .:.:::..|:..|..:| |.|.|.
Mosquito   131 ------NTAVFPVKMARTYTP-ANRAVLASGWGLTTLSVPKPADRLQYVALRTISNED-CSERFR 187

  Fly   313 KDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGI 377
            |.....:..|.:|........:|.|||||||..:..         |.|:||.|.. |... :..:
Mosquito   188 KLQNRAITPSILCTFSRNEQGTCMGDSGGPLVEDGE---------LVGIVSWGIP-CAVG-YPDV 241

  Fly   378 YTRVSSYMDWI 388
            |.||||:..||
Mosquito   242 YVRVSSFRAWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 72/269 (27%)
Tryp_SPc 133..391 CDD:238113 73/269 (27%)
AgaP_AGAP011918XP_001689276.1 Tryp_SPc 31..252 CDD:214473 72/269 (27%)
Tryp_SPc 32..252 CDD:238113 71/268 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.