DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP001249

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_001689375.2 Gene:AgaP_AGAP001249 / 5667667 VectorBaseID:AGAP001249 Length:267 Species:Anopheles gambiae


Alignment Length:257 Identity:77/257 - (29%)
Similarity:117/257 - (45%) Gaps:41/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 FSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILG 192
            ::.|:|||....:.:||:...|..     ..::.||||.|:..|.|:||||...|....:.:..|
Mosquito    38 YNGRIVGGSTVPISQFPYQLSLRQ-----NGNHICGASVISSNWALSAAHCTFPMPSAASISFRG 97

  Fly   193 EWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLE 257
            ..:..|.       .||...|.        :|:.|.||:..|..||:.::|::..   ....|:.
Mosquito    98 GSDSRTG-------GGVIFQAA--------QIINHPQYNSNNLNNDVCVIRITTS---FVGANIA 144

  Fly   258 PVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAM-LHIQPQDQCQEAFYKDTKITLAD 321
            |:.|......:|   ||:.:.|||||.|...||..:...|: :.:..|..|... :...:||.| 
Mosquito   145 PIRLVASGTSFA---AGTNSVVSGWGLTSPGGSLPVNLHAVNIPVVAQATCSSQ-WGTGRITAA- 204

  Fly   322 SQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSS 383
             .:|||.: |.|||:|||||||     ...|.::    ||||.|...||..| .|:|..:.:
Mosquito   205 -MVCAGVQ-GRDSCNGDSGGPL-----VTGGAQF----GVVSWGAVQCGGPL-PGVYANIGN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 77/254 (30%)
Tryp_SPc 133..391 CDD:238113 76/252 (30%)
AgaP_AGAP001249XP_001689375.2 Tryp_SPc 41..254 CDD:214473 77/252 (31%)
Tryp_SPc 42..264 CDD:238113 76/253 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.