DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP005596

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_001688689.1 Gene:AgaP_AGAP005596 / 5666841 VectorBaseID:AGAP005596 Length:266 Species:Anopheles gambiae


Alignment Length:261 Identity:55/261 - (21%)
Similarity:96/261 - (36%) Gaps:73/261 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 EFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAH-CIH-------TMGRNLTAAILGEWNRDT 198
            :||:.|.:|...|      .|..:.|...::::.|. |::       ..|..:.|.....|.:  
Mosquito    56 QFPYLTFIENNGV------VCNGALITPNYIVSVARGCLNRSTIKTAQYGTAILAFNKNMWEQ-- 112

  Fly   199 DPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPP 263
                                    ||...|....|:...||||.||:.|..  ..::::|:.|| 
Mosquito   113 ------------------------RINFSASAINLHPYEDIALARLNYPAT--LNKHVQPIRLP- 150

  Fly   264 QRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGG 328
                   :|:.|.:.|...|.|.:: :..::.:.|.:.    :|.:. :.:...|..|  :|...
Mosquito   151 -------KLSDSRSYVDMEGTTVAT-NRYVRNRVMSNA----ECTKE-HPNFNATHVD--ICTDR 200

  Fly   329 EIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKH----CGTALFSGIYTRVSSYMDWIE 389
            ..|...||...|.|||:|...          ||:.||..:    |.....:| |.|:..:.|||.
Mosquito   201 YKGGAFCSFFLGSPLTIEDEN----------GVILIGLANWISSCDNNYPTG-YARILPFRDWIH 254

  Fly   390 S 390
            :
Mosquito   255 N 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 53/257 (21%)
Tryp_SPc 133..391 CDD:238113 55/261 (21%)
AgaP_AGAP005596XP_001688689.1 Tryp_SPc 54..256 CDD:304450 55/261 (21%)
Tryp_SPc 54..253 CDD:214473 53/257 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.