DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Klk11

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:276 Identity:81/276 - (29%)
Similarity:123/276 - (44%) Gaps:57/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWN 195
            |::.|:.......||...|..:|     ...|||:.||.:||||||||    .:.....:|||.|
Mouse    47 RIIKGYECRPHSQPWQVALFQKT-----RLLCGATLIAPKWLLTAAHC----RKPHYVILLGEHN 102

  Fly   196 RDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYS----ELNYRNDIALLRLSRPVNW---LQM 253
            .:....||.             |.......||..::    ..::||||.|:::|.||.:   :|.
Mouse   103 LEKTDGCEQ-------------RRMATESFPHPDFNNSLPNKDHRNDIMLVKMSSPVFFTRAVQP 154

  Fly   254 QNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQK---AMLHIQPQDQCQEAFYKDT 315
            ..|.|.|:          .||::..:|||| |.||...::...   |.:.|....:|::|:..: 
Mouse   155 LTLSPHCV----------AAGTSCLISGWG-TTSSPQLRLPHSLRCANVSIIEHKECEKAYPGN- 207

  Fly   316 KITLADSQMCAG-GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYT 379
               :.|:.:||. .:.|.|||.|||||||....:         |.|::|.|:..|......|:||
Mouse   208 ---ITDTMLCASVRKEGKDSCQGDSGGPLVCNGS---------LQGIISWGQDPCAVTRKPGVYT 260

  Fly   380 RVSSYMDWIESTIRAN 395
            :|..|.:||...:|.|
Mouse   261 KVCKYFNWIHEVMRNN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 77/267 (29%)
Tryp_SPc 133..391 CDD:238113 78/268 (29%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 77/267 (29%)
Tryp_SPc 48..272 CDD:238113 78/269 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.