DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and zgc:112285

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001020685.1 Gene:zgc:112285 / 561476 ZFINID:ZDB-GENE-050913-132 Length:316 Species:Danio rerio


Alignment Length:278 Identity:82/278 - (29%)
Similarity:124/278 - (44%) Gaps:44/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDY--ACGASFIAQRWLLTAAHCIHTMGRNLTAA---- 189
            |:|.|:......:||...|:... .|.|.|  .||.:.|.:.|:||||||.. .|:...|:    
Zfish    58 RIVSGNEARPHSWPWQVSLQVRP-RGSKHYVHVCGGTLIHKNWVLTAAHCFQ-KGKAEDASSWRI 120

  Fly   190 ILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLS---RPVNWL 251
            :||:.........|......|.....|.|        :..:|||:|  ||||::.:   :|.|::
Zfish   121 VLGKHQLKRSETAERFFPVKRIYRHEHFR--------YPAHSELDY--DIALVKAATDIQPSNFI 175

  Fly   252 QMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKT----ESSGSSKIKQKAMLHIQPQDQC-QEAF 311
            :.     .|||.::   .|...|....|:|||.|    |:...::...:|.|.|.....| |:.|
Zfish   176 RY-----ACLPRKQ---INLNPGHYCWVTGWGDTRGGKENVSLAEALNQARLPIIDYKTCRQKKF 232

  Fly   312 YKDTKITLADSQMCAG---GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTAL 373
            :.|   .:.||.:|||   .|....:|.|||||||..:.    |.....:.|:||.|...|....
Zfish   233 WGD---RVRDSMICAGFRDTEGTPAACQGDSGGPLLCQV----GRDRWEVHGIVSFGPIGCTVEN 290

  Fly   374 FSGIYTRVSSYMDWIEST 391
            ...::||.::|:.|||:|
Zfish   291 KPSVFTRTAAYIPWIEAT 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 78/273 (29%)
Tryp_SPc 133..391 CDD:238113 80/274 (29%)
zgc:112285NP_001020685.1 Tryp_SPc 58..305 CDD:214473 78/273 (29%)
Tryp_SPc 59..308 CDD:238113 80/275 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.