DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and C1s1

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001091086.1 Gene:C1s1 / 50908 MGIID:1355312 Length:694 Species:Mus musculus


Alignment Length:319 Identity:88/319 - (27%)
Similarity:130/319 - (40%) Gaps:81/319 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIA 168
            |||..  |..|:   |..|:   ....|:.||....:..|||.....:...||        :.|.
Mouse   424 LPRCI--PACGV---PTEPF---QVHQRIFGGQPAKIENFPWQVFFNHPRASG--------ALIN 472

  Fly   169 QRWLLTAAHCIH----------TMGRNLT------------AAILGEWNRDTDPDCENDLNGVRE 211
            :.|:|||||.:.          ||....|            ..|...|.::.||:          
Mouse   473 EYWVLTAAHVLEKISDPLMYVGTMSVRTTLLENAQRLYSKRVFIHPSWKKEDDPN---------- 527

  Fly   212 CAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSA 276
                               :..|:.|||||::|..||.  ....:.|:|||.....| |...|..
Mouse   528 -------------------TRTNFDNDIALVQLKDPVK--MGPKVSPICLPGTSSEY-NVSPGDM 570

  Fly   277 ADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKI-----TLADSQMCAGGEIGVDSCS 336
            ..:||||.||........:.|.:.:...:.|::...::..:     ...|:.:|| ||.|||||.
Mouse   571 GLISGWGSTEKKVFVINLRGAKVPVTSLETCKQVKEENPTVRPEDYVFTDNMICA-GEKGVDSCH 634

  Fly   337 GDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIRAN 395
            |||||....:....:..:: |:||:||.| |.|||   .|:||:|.:|:|||..|::.|
Mouse   635 GDSGGAFAFQVPNVTVPKF-YVAGLVSWG-KRCGT---YGVYTKVKNYVDWILKTMQEN 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 77/283 (27%)
Tryp_SPc 133..391 CDD:238113 78/284 (27%)
C1s1NP_001091086.1 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:373209
CUB 181..293 CDD:366096
CCP 307..361 CDD:153056
CCP 365..428 CDD:153056 3/3 (100%)
Tryp_SPc 443..681 CDD:214473 77/283 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFCY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.