DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Prss44

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:356 Identity:104/356 - (29%)
Similarity:161/356 - (45%) Gaps:81/356 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PRETNIIPPLAPRIS-NGTTN--ATSSTTTLKLLPRTT-PRPPSG----IDQL---PEHPY---- 123
            |.....:|.|:|..| ||..:  .......|..:|.|: |..|.|    .|.:   |.|.:    
  Rat    26 PMVPGTLPSLSPLPSENGLDDPGVNPQERPLTGMPETSLPLKPGGSMTPFDSMGFTPGHSFSSMS 90

  Fly   124 ---------------CGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLL 173
                           ||.. :.|:|||....:.::||...|:..     |.:.||.|.|::.|::
  Rat    91 LSRQSFPPWIPPTSACGHR-TARIVGGKPAPIRKWPWQVSLQVH-----KQHICGGSLISKWWVM 149

  Fly   174 TAAHCIHTMGRNLTAAILGE---WNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSEL-N 234
            |||||::  |.......:||   |:..:                  :::.:..|:.|..||.: .
  Rat   150 TAAHCVY--GHLDYVVSMGEADLWSSMS------------------VKIPVQDIIVHQDYSVMRT 194

  Fly   235 YRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKT-ESSGSSKIKQKAM 298
            ..:||||:.|:.|||:  ..|::|||:|.:  .:..| .|:...|:||||| |...||::.::..
  Rat   195 IVHDIALVLLAFPVNY--SVNIQPVCIPEK--SFLVQ-PGTLCWVTGWGKTIERGRSSRVLREVD 254

  Fly   299 LHIQPQDQCQEAFYKDTKIT------LADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVY 357
            |.|...::|.: ..||  ||      :.:..:|...:.|.|:|.||||||:..|.|    ..:|.
  Rat   255 LSIIRHERCNQ-ILKD--ITGRIFTLVQEGGVCGYNKKGGDACQGDSGGPMVCEFN----KTWVQ 312

  Fly   358 LAGVVSIGRKHCGTALFSGIYTRVSSYMDWI 388
            : |:||.| ..||...:.||||.||.|.|||
  Rat   313 V-GIVSWG-LGCGRIGYPGIYTEVSYYRDWI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 104/356 (29%)
Tryp_SPc 131..388 CDD:214473 84/267 (31%)
Tryp_SPc 133..391 CDD:238113 85/267 (32%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 84/267 (31%)
Tryp_SPc 113..341 CDD:238113 83/266 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.