DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Tmprss11f

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_038948844.1 Gene:Tmprss11f / 498345 RGDID:1560675 Length:459 Species:Rattus norvegicus


Alignment Length:322 Identity:94/322 - (29%)
Similarity:140/322 - (43%) Gaps:71/322 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGL-FEFPWT 146
            |.|..|....|..:|...:::.....|.|.|...:             |:|.|..|.: .|:||.
  Rat   191 LTPIDSKKMRNLLNSRCGIRMSSSNIPLPASSTTE-------------RIVQGRETAMEGEWPWQ 242

  Fly   147 TLLEYETVSGGKDYACGASFIAQRWLLTAAHC----------IHTMGRNLTAAILGEWNRDTDPD 201
            ..|:..    |..:.|||:.|:..||||||||          |.|.|..:|              
  Rat   243 ASLQLI----GAGHQCGATLISNTWLLTAAHCFWKNRDPSKWIATFGTTIT-------------- 289

  Fly   202 CENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRG 266
                        ||.::.::.||:.|.:|...:..|||||.:|:..|.:..:  ::.||||....
  Rat   290 ------------PPLVKRSVGRIIIHEEYHRDSNENDIALAQLTSRVEFSNV--VQRVCLPDSSM 340

  Fly   267 RYANQLAGSAADVSGWGKTESSGSSKIK-QKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEI 330
            :...:   ::..|:|:|.....|.::.| ::|.:.....|.|.:....|..||  ...:|||...
  Rat   341 KLPPK---TSVFVTGFGSIVDDGPTQNKLRQARVETIGSDVCNQKDVYDGLIT--PGMLCAGFME 400

  Fly   331 G-VDSCSGDSGGPLTVEANTASGNRYV-YLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIES 390
            | ||:|.|||||||..:      ||.: |:.|:||.|:. |......|:|||||.|.|||.|
  Rat   401 GKVDACKGDSGGPLVYD------NRDIWYIVGIVSWGQS-CALPNKPGVYTRVSKYRDWIAS 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 83/270 (31%)
Tryp_SPc 133..391 CDD:238113 85/272 (31%)
Tmprss11fXP_038948844.1 SEA 80..185 CDD:396113
Tryp_SPc 227..456 CDD:238113 85/273 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.