DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and cela1.2

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001011493.1 Gene:cela1.2 / 496993 XenbaseID:XB-GENE-5739190 Length:265 Species:Xenopus tropicalis


Alignment Length:281 Identity:87/281 - (30%)
Similarity:130/281 - (46%) Gaps:62/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDY-ACGASFIAQRWLLTAAHCIHTMGRNLT-AAILGE 193
            |::||.......:||...|:|  :|||..| .||.|.|....:||||||:   .|.:: ..::|:
 Frog    28 RVIGGTEVQRNSWPWQVSLQY--LSGGSWYHTCGGSLIRANRVLTAAHCV---DRAVSYRVVVGD 87

  Fly   194 WNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYR--NDIALLRLSRPVNWLQMQNL 256
            .|     ..:||  |..:      .:::.||:.||.::..|..  .||::|.||....       
 Frog    88 HN-----IYQND--GTEQ------YISVSRIVKHANWNPNNIAAGYDISILHLSSSAT------- 132

  Fly   257 EPVCLPPQRGRYANQLAGSAAD-----------VSGWGKTESSGS-SKIKQKAMLHIQPQDQCQE 309
                    ...|. :||...||           |:|||||.::|: :.:.|:|.|.:.....|..
 Frog   133 --------LNSYV-KLAQLPADNVVLAHNYNCVVTGWGKTSNNGNLASVLQQAPLPVIAHSTCSS 188

  Fly   310 AFYKDTKITLADSQMCAGGEIGVDS-CSGDSGGPLTVEANTASGNRYVY-LAGVVS-IGRKHCGT 371
            ..|..:  |:..:.:||||: ||.| |.|||||||....|.      || :.||.| :....|.|
 Frog   189 GSYWGS--TVKSTMVCAGGD-GVRSGCQGDSGGPLNCPVNG------VYQVHGVTSFVSSSGCST 244

  Fly   372 ALFSGIYTRVSSYMDWIESTI 392
            .|...::||||:|:.||.:.|
 Frog   245 YLKPTVFTRVSAYIGWINNNI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 84/275 (31%)
Tryp_SPc 133..391 CDD:238113 85/276 (31%)
cela1.2NP_001011493.1 Tryp_SPc 29..264 CDD:238113 85/277 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.