DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and prtn3-like.2

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_002940708.1 Gene:prtn3-like.2 / 496767 XenbaseID:XB-GENE-5764783 Length:312 Species:Xenopus tropicalis


Alignment Length:276 Identity:79/276 - (28%)
Similarity:126/276 - (45%) Gaps:40/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNL 186
            |:.|::   |:|||........|:...|:....     :.||.:.|.::|:||||||:.....:.
 Frog    75 PFSGAS---RIVGGREARAHSRPYIASLQIRGF-----HFCGGALINEKWVLTAAHCMEDTPVDS 131

  Fly   187 TAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWL 251
            ...:||..|... ||     :.|:|       ..:...:.:.:|:...::|||.||:|:...  :
 Frog   132 VRVVLGAHNLQR-PD-----SLVQE-------FRVQESVQNPEYNPTTFQNDIHLLKLNDSA--V 181

  Fly   252 QMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTK 316
            ....:..:.||......|.:   |...|:|||.....|:|   .:|::........::|..:...
 Frog   182 ITSGVRTIRLPVPNSDVAPR---SNCSVAGWGDINDFGTS---PRALMQTNADIISRQACNRSWG 240

  Fly   317 ITLADSQMCAG--GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYT 379
            ..:.::.:||.  |.:....|||||||||...      ||   |.|.||...:.||.|:|..:||
 Frog   241 GAITNTMLCAATPGVLAKGFCSGDSGGPLVCR------NR---LEGAVSFSGRFCGNAMFPDVYT 296

  Fly   380 RVSSYMDWIESTIRAN 395
            |||||:.|||:.||.|
 Frog   297 RVSSYLPWIETVIRQN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 71/258 (28%)
Tryp_SPc 133..391 CDD:238113 73/259 (28%)
prtn3-like.2XP_002940708.1 Tryp_SPc 81..305 CDD:214473 71/258 (28%)
Tryp_SPc 82..308 CDD:238113 73/260 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.