DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and tll1

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001008039.1 Gene:tll1 / 493401 XenbaseID:XB-GENE-479941 Length:495 Species:Xenopus tropicalis


Alignment Length:226 Identity:42/226 - (18%)
Similarity:69/226 - (30%) Gaps:84/226 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 RISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLL- 149
            |:.:|.|     |:...:|.:|                ||:.....::...|..|.||...:.: 
 Frog   326 RVYDGAT-----TSAPMILDKT----------------CGTGPLPVMIASTNRMLVEFVTDSAIT 369

  Fly   150 ------EYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDP--DCENDL 206
                  .|.||.      ||.:|             :|..||:|..   .:.:...|  ||:..:
 Frog   370 APGFKASYSTVQ------CGGTF-------------YTPSRNVTTP---NYPKSYPPNLDCQFII 412

  Fly   207 NGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYA-- 269
            .     ||...:|.            ||..|.......:...::|::.:...:..|....||.  
 Frog   413 T-----APTSYKVA------------LNINNFFVEKSANCQYDYLEIYDGNSMSAPKIGSRYCSY 460

  Fly   270 ---NQLAGSA----------ADVSGWGKTES 287
               |.:..|.          |.|..:|.|.|
 Frog   461 QVFNVMVSSGRSMLLRFHSDASVQMYGFTAS 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 34/181 (19%)
Tryp_SPc 133..391 CDD:238113 34/179 (19%)
tll1NP_001008039.1 ZnMc_hatching_enzyme 83..265 CDD:239810
CUB 269..379 CDD:238001 13/73 (18%)
CUB 382..494 CDD:238001 27/143 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.