Sequence 1: | NP_572582.1 | Gene: | Ser7 / 31917 | FlyBaseID: | FBgn0019929 | Length: | 397 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001008039.1 | Gene: | tll1 / 493401 | XenbaseID: | XB-GENE-479941 | Length: | 495 | Species: | Xenopus tropicalis |
Alignment Length: | 226 | Identity: | 42/226 - (18%) |
---|---|---|---|
Similarity: | 69/226 - (30%) | Gaps: | 84/226 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 RISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLL- 149
Fly 150 ------EYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDP--DCENDL 206
Fly 207 NGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYA-- 269
Fly 270 ---NQLAGSA----------ADVSGWGKTES 287 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ser7 | NP_572582.1 | CLIP | 29..74 | CDD:197829 | |
Tryp_SPc | 131..388 | CDD:214473 | 34/181 (19%) | ||
Tryp_SPc | 133..391 | CDD:238113 | 34/179 (19%) | ||
tll1 | NP_001008039.1 | ZnMc_hatching_enzyme | 83..265 | CDD:239810 | |
CUB | 269..379 | CDD:238001 | 13/73 (18%) | ||
CUB | 382..494 | CDD:238001 | 27/143 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |