DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP012502

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_001230484.2 Gene:AgaP_AGAP012502 / 4578454 VectorBaseID:AGAP012502 Length:829 Species:Anopheles gambiae


Alignment Length:264 Identity:83/264 - (31%)
Similarity:122/264 - (46%) Gaps:41/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 EFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDT--DPDC-- 202
            ||.....:.:....|..::.||.|.|...::||||||..              :|||  .||.  
Mosquito    26 EFSAIAAIGWTKPGGTVNWNCGGSLIWANFILTAAHCTK--------------DRDTLLPPDIIR 76

  Fly   203 ENDLN--GVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVN-WLQMQNLEPVCLPPQ 264
            ..|||  ..||.|....| ||.|::.|..|:..:...|||||.|:..|| :.::.   |.||   
Mosquito    77 IGDLNLYDDREDALVQER-TIIRVIRHPLYNTSSVFYDIALLMLNEKVNIYFEVM---PTCL--- 134

  Fly   265 RGRYANQLAGSAADVSGWGKTE-SSGSSKIKQKAMLHIQPQDQCQEAFYK---DTKITLADSQMC 325
              ...:.:..|..:.:|||.:. ..|.:.|..||.|.:.....| |::|.   ..|..|.:.|:|
Mosquito   135 --WLDDNIPFSKVEAAGWGTSGFGYGKTNILIKAELKLMANKDC-ESYYSQVASVKNGLMEHQLC 196

  Fly   326 AGGEIGVDSCSGDSGGPLTVEANTASGNRYV-YLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIE 389
            |..:: :|:|.|||||||  :.....|:..| :|.||.|.|.. ||.:. .|:|.:||.:..||.
Mosquito   197 AWDKV-MDTCPGDSGGPL--QHKLIFGDYKVPFLVGVTSFGLS-CGNSQ-PGVYVKVSKFGSWIV 256

  Fly   390 STIR 393
            .|::
Mosquito   257 ETLQ 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 80/257 (31%)
Tryp_SPc 133..391 CDD:238113 82/260 (32%)
AgaP_AGAP012502XP_001230484.2 Tryp_SPc 19..258 CDD:238113 82/260 (32%)
Tryp_SPc 19..255 CDD:214473 80/257 (31%)
Tryp_SPc 325..>418 CDD:304450
Trypsin 621..823 CDD:278516
Tryp_SPc 629..826 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.