powered by:
Protein Alignment Ser7 and AgaP_AGAP011430
DIOPT Version :9
Sequence 1: | NP_572582.1 |
Gene: | Ser7 / 31917 |
FlyBaseID: | FBgn0019929 |
Length: | 397 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001237985.1 |
Gene: | AgaP_AGAP011430 / 4577519 |
VectorBaseID: | AGAP011430 |
Length: | 261 |
Species: | Anopheles gambiae |
Alignment Length: | 61 |
Identity: | 30/61 - (49%) |
Similarity: | 40/61 - (65%) |
Gaps: | 2/61 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 332 VDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTI 392
:|:|.|||||||..:.:...||.:..:.||||.|.. | |...:|:|||||||:||||..:
Mosquito 1 MDTCEGDSGGPLQTDRHDLFGNTFPLVVGVVSFGTP-C-TDGSTGVYTRVSSYLDWIEKEV 59
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.