DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP005587

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_001237684.2 Gene:AgaP_AGAP005587 / 4576204 VectorBaseID:AGAP005587 Length:296 Species:Anopheles gambiae


Alignment Length:257 Identity:59/257 - (22%)
Similarity:91/257 - (35%) Gaps:53/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 EFPWTTLLEYETVSGGKDY-----ACGASFIAQRWLLTAAHCI--HTMGRNLTAAILGEWNRDTD 199
            :||:..|: |......|.:     ....|.|...::||:|..:  :.:|...|...:....|   
Mosquito    73 QFPYHALV-YINNENPKPWESSIVQTAGSLITPNYILTSAEVLRKNILGNGKTYGFVELGYR--- 133

  Fly   200 PDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQ 264
                   ||........|..|...|..|.::|...:.| ||.:||..|..  ..:.::|:.||  
Mosquito   134 -------NGADRERQQVIDFTNSSISIHPRFSGGLFYN-IATIRLEHPAT--LNRYVQPIRLP-- 186

  Fly   265 RGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGE 329
              |.::.......:.:..|. ..:|:.:..:..:|   |.|.|           |....:|....
Mosquito   187 --RLSDNRTFEMMEGTSLGH-HYNGTMRYMRNQVL---PHDNC-----------LLQEYVCTNSF 234

  Fly   330 IGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIG---RKHCGTALFSGIYTRVSSYMDWI 388
            ||...|:...|..||||...          |.:.||   |.:........|.||||.|.|||
Mosquito   235 IGGAFCNRVDGAGLTVEDED----------GPILIGFTMRVYWCDLNERDINTRVSVYRDWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 57/255 (22%)
Tryp_SPc 133..391 CDD:238113 59/257 (23%)
AgaP_AGAP005587XP_001237684.2 Tryp_SPc 54..286 CDD:214473 57/255 (22%)
Tryp_SPc 66..289 CDD:304450 59/257 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.