DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP000411

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_001237291.3 Gene:AgaP_AGAP000411 / 4576124 VectorBaseID:AGAP000411 Length:1091 Species:Anopheles gambiae


Alignment Length:270 Identity:69/270 - (25%)
Similarity:121/270 - (44%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 VGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAI----LGE 193
            :.||      :||...: :......|:||||.|.:.:..:|||:||:.|:...::||:    :|:
Mosquito    30 IAGH------WPWHAAI-FHQKDKHKEYACGGSILDETTILTASHCVSTLSGVISAALVTVHVGQ 87

  Fly   194 WNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEP 258
            .:.:...:...... .||            |:.:..:|:.:..:||||::|.  .|....:.::|
Mosquito    88 IHLNQSSEYTQTFE-ARE------------IIINPGFSKASIIHDIALIKLR--TNISMNRYVQP 137

  Fly   259 VCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQC--QEAFYKDTKITLAD 321
            |||...... ...:.|....:.|:|.:|....|:..::|.:.:.....|  .:.....|.:||  
Mosquito   138 VCLWTMDSA-LELIVGRNGTIVGFGLSERDVVSEQLKQATIGVVDPYTCIASDRVVYGTHLTL-- 199

  Fly   322 SQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSI----GRKHCGTALFSGIYTRVS 382
            ...|..|:.||.:|:|||||.:..|   .||..:|  .|:||.    |.......|...:||.|:
Mosquito   200 EMFCGKGQNGVSACNGDSGGGMFFE---VSGRWFV--RGLVSFTPARGSSGLCDPLKYTVYTDVA 259

  Fly   383 SYMDWIESTI 392
            .|::||:..|
Mosquito   260 KYVEWIKQYI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 66/264 (25%)
Tryp_SPc 133..391 CDD:238113 68/267 (25%)
AgaP_AGAP000411XP_001237291.3 Tryp_SPc 23..267 CDD:238113 68/266 (26%)
Tryp_SPc 25..265 CDD:214473 66/264 (25%)
Tryp_SPc 308..>462 CDD:304450
Trypsin 838..1069 CDD:278516
Tryp_SPc 864..>946 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.