DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP012777

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_001230468.2 Gene:AgaP_AGAP012777 / 4397664 VectorBaseID:AGAP012777 Length:465 Species:Anopheles gambiae


Alignment Length:200 Identity:53/200 - (26%)
Similarity:89/200 - (44%) Gaps:33/200 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 LNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYAN 270
            |..|.|....|   |:..::.|..|:...:.|||||::|:..:...:.  ::||||....   .|
Mosquito     1 LKEVSEFVQEH---TVQELIVHPGYNSSRFVNDIALIKLTESITMSEF--VQPVCLWTMD---KN 57

  Fly   271 Q--LAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLAD----SQMCAGGE 329
            |  :.|....:.|:|..|....|:..::|.:.:.....|    .|..:::.|:    ...|.||:
Mosquito    58 QELIVGKTGTLVGFGLNEQDVVSEQLKQASIGVVDALTC----IKSDRLSFANQLTAEMFCGGGQ 118

  Fly   330 IGVDSCSGDSGGPL--TVEANTASGNRYVYLAGVVSI--GRKH---CGTALFSGIYTRVSSYMDW 387
            ..|.:|:|||||.|  .||...       ::.||||.  .|:.   |..:.::. |..|:.|:.|
Mosquito   119 SNVSACNGDSGGGLFFNVEGKW-------FVRGVVSFIPVRQRTGLCDPSKYTA-YADVAKYLGW 175

  Fly   388 IESTI 392
            |:..|
Mosquito   176 IDQYI 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 50/194 (26%)
Tryp_SPc 133..391 CDD:238113 52/197 (26%)
AgaP_AGAP012777XP_001230468.2 Tryp_SPc <1..178 CDD:238113 52/196 (27%)
Tryp_SPc <4..176 CDD:214473 49/191 (26%)
Tryp_SPc 219..458 CDD:214473
Tryp_SPc 219..458 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.