DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP012778

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_001230340.2 Gene:AgaP_AGAP012778 / 4397620 VectorBaseID:AGAP012778 Length:276 Species:Anopheles gambiae


Alignment Length:273 Identity:76/273 - (27%)
Similarity:116/273 - (42%) Gaps:52/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 AFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCI-HTMGRNLTAAI 190
            |.|.|::||  :.:....|...:. |.|:|.....||.:.|.::|:||||||: :.....:..||
Mosquito    38 AGSQRIIGG--SAVTAPSWMVAVG-EVVNGNWSNFCGGTLIDKQWVLTAAHCVANAQSGPMEVAI 99

  Fly   191 LGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQY-----SELNYR-----NDIALLRLS 245
                             ||.:.:.||.|..:|::|.|.:|     |.|.||     :|:|||.|:
Mosquito   100 -----------------GVSDLSRPHTRSKVDQVLMHPEYYVNLLSNLGYRETPYSSDVALLHLA 147

  Fly   246 RPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEA 310
            .||      ...|:.:.....:...|...:.....|:|......:....|...:.:..:.: ::.
Mosquito   148 TPV------TQAPIVMADITTKDTWQWNTTMLHAIGYGGINPDATKSSPQLLAVDLAYRGE-RDY 205

  Fly   311 FYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFS 375
            :|.|...|    .:.||...|.|:|.||||||||.      |.:   |.||.|.|...|.|....
Mosquito   206 WYGDPTTT----HIFAGKLAGQDTCKGDSGGPLTY------GGK---LVGVTSYGAFPCATGSAG 257

  Fly   376 GIYTRVSSYMDWI 388
            | ||...::.|||
Mosquito   258 G-YTYAPAFSDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 72/267 (27%)
Tryp_SPc 133..391 CDD:238113 73/267 (27%)
AgaP_AGAP012778XP_001230340.2 Tryp_SPc 42..269 CDD:214473 72/267 (27%)
Tryp_SPc 43..269 CDD:238113 71/266 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.