DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and zgc:92313

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001002596.1 Gene:zgc:92313 / 436869 ZFINID:ZDB-GENE-040718-339 Length:309 Species:Danio rerio


Alignment Length:282 Identity:79/282 - (28%)
Similarity:122/282 - (43%) Gaps:60/282 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKD-YACGASFIAQRWLLTAAHCIHT----------MGR 184
            |:|||.:.....:||..     .:.|.|. :.||.:.|::.|:|:||||...          .||
Zfish    34 RIVGGSSAADGAWPWQV-----DIQGEKSKHVCGGTIISENWVLSAAHCFPNPNDISGYLIYAGR 93

  Fly   185 NLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVN 249
            ..    |..||                  |......|.|::....|::.....||||:.|:.|  
Zfish    94 QQ----LNGWN------------------PDETSHRISRVVVPLGYTDPQLGQDIALVELATP-- 134

  Fly   250 WLQMQNLEPVCLPPQRGRYANQ--LAGSAADVSGWGKTES----SGSSKIKQKAMLHIQPQDQCQ 308
            ::..:.::|||||     |||.  .:.....::|||....    .|...: |:..:.|.....||
Zfish   135 FVYTERIQPVCLP-----YANVEFTSDMRCMITGWGDIREGVALQGVGPL-QEVQVPIIDSQICQ 193

  Fly   309 EAFYKD--TKITLADSQMCAG-GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCG 370
            :.|..:  ..|.:....|||| .:.|.|||.|||||||..:.:..|..:    ||:||.| ..|.
Zfish   194 DMFLTNPTENIDIRPDMMCAGFQQGGKDSCQGDSGGPLACQISDGSWVQ----AGIVSFG-LGCA 253

  Fly   371 TALFSGIYTRVSSYMDWIESTI 392
            .|...|:|.:|||:.::|::.:
Zfish   254 EANRPGVYAKVSSFTNFIQTHV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 78/276 (28%)
Tryp_SPc 133..391 CDD:238113 78/277 (28%)
zgc:92313NP_001002596.1 Tryp_SPc 34..271 CDD:214473 78/276 (28%)
Tryp_SPc 35..274 CDD:238113 78/278 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.