DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG9733

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:451 Identity:143/451 - (31%)
Similarity:202/451 - (44%) Gaps:90/451 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLLIPLFLTLL---GAEAQQFGKAIMHFGNCNSVEFGRGTCIEKKDCD-FYAVDKLMELASKQQ 61
            |.:...:||.:|   .|:||...:.:    |.|...   |.|:...:|. .|:|.|...|..:::
  Fly     1 MKVFAAVFLCILIAHEAKAQSDSRCL----NPNQTP---GLCVLINECQTLYSVLKRATLTDQEK 58

  Fly    62 CF---------SRQRPDLVCCPRETNII-----------------------PP--LAPR-----I 87
            .|         |..:| .|||.::|..:                       |.  :.||     .
  Fly    59 SFIKSSACGRGSNNQP-YVCCTQDTGYVRIQRQDRTFPDYGAFGGDWEEERPQSFVFPRQERRPW 122

  Fly    88 SNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGS-AFSFRLVGGHNTGLFEFPWTTLLEY 151
            |.|...|||.|      |........|...||:.|.||. ....|:..|.:|.:.||||..||||
  Fly   123 SFGNQPATSRT------PFRKSSTSDGSSLLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEY 181

  Fly   152 ETVSG-GKDYACGASFIAQRWLLTAAHCIHTMGR------NLTAAILGEWNRDTDPDCENDLNGV 209
            ...|| |...||..|.|.:|::||||||:  .||      .|.:..|||.:..|..||.   .|.
  Fly   182 RRRSGNGLSTACAGSLINRRYVLTAAHCL--TGRIEREVGTLVSVRLGEHDTRTAVDCP---PGG 241

  Fly   210 RECAPPHIRVTIDRILPHAQYSE--LNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQL 272
            ..|:|...|:..:.|..|.:|||  .|..:||.|:|:.|.|.:  ..|::|:|||...|..:.| 
  Fly   242 GSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRY--SDNIQPICLPSSVGLESRQ- 303

  Fly   273 AGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSG 337
            :|....|:|||:|.....|.:|||..::.....:|::.| ...|:.|..:|:||||:...|||.|
  Fly   304 SGQQFTVAGWGRTLKMARSAVKQKVTVNYVDPAKCRQRF-SQIKVNLEPTQLCAGGQFRKDSCDG 367

  Fly   338 DSGGPLTVEANTASGNRY----VYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIRA 394
            ||||||.         |:    ..|.|:||.|.| ||...:.|:||.|::|..||...:||
  Fly   368 DSGGPLM---------RFRDESWVLEGIVSFGYK-CGLKDWPGVYTNVAAYDIWIRQNVRA 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 13/54 (24%)
Tryp_SPc 131..388 CDD:214473 100/269 (37%)
Tryp_SPc 133..391 CDD:238113 101/270 (37%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855 13/60 (22%)
Tryp_SPc 161..412 CDD:214473 100/269 (37%)
Tryp_SPc 162..415 CDD:238113 101/271 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25969
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.