DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG9737

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:414 Identity:133/414 - (32%)
Similarity:180/414 - (43%) Gaps:82/414 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EFGRGTCIEKKDCDFY---------AVDKLMELASKQQCFSRQR--------PDLVCCPRETNII 80
            |..||.|:|...|..|         ..:| :....|.||...|:        ..|||||      
  Fly    33 ETKRGVCLEVSRCKAYLQVRNATNLPAEK-VNFLKKVQCEVEQQVSEAQGSYESLVCCP------ 90

  Fly    81 PPLAPRISNGT-----------------TNATSSTTTLKLLPR-TTPRPPSGIDQLPEHPYCGSA 127
                   :||.                 .:.|:.....||..| .|..|.||.:.|.|   ||..
  Fly    91 -------ANGQDYLFPVLQFSKFEYRRFLDVTARFKRKKLKRRIQTVEPSSGFNLLNE---CGKQ 145

  Fly   128 FSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMG----RNLTA 188
            .:.|:.||....|.||||..||.|.:    .||.|..:.|..|.:||||||:...|    :.|..
  Fly   146 VTNRIYGGEIAELDEFPWLALLVYNS----NDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKH 206

  Fly   189 AILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSEL-NYR-NDIALLRLSRPVNWL 251
            ..|||:|..|:|||..:.|.: .||...:.:..::|..|.:|.|. ||: ||||::||..||::.
  Fly   207 VRLGEFNVKTEPDCIEEPNYL-SCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFT 270

  Fly   252 QMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGS------SKIKQKAMLHIQPQDQCQ-- 308
            ..  :.|:|| |.:........|....|||||:|:....      |.||.|..:.....:.|.  
  Fly   271 HF--VMPICL-PNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKI 332

  Fly   309 -EAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTA 372
             |.|    .:.|...|:|||||...|:|:|||||||.......|  |:| ..||||.|...||.|
  Fly   333 LEGF----GVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHS--RWV-AYGVVSYGFTQCGMA 390

  Fly   373 LFSGIYTRVSSYMDWIESTIRANR 396
            ....:||.|:.|.|||:|.::..:
  Fly   391 GKPAVYTNVAEYTDWIDSVVQQRK 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 15/57 (26%)
Tryp_SPc 131..388 CDD:214473 99/271 (37%)
Tryp_SPc 133..391 CDD:238113 100/272 (37%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855 14/56 (25%)
Tryp_SPc 149..406 CDD:214473 99/271 (37%)
Tryp_SPc 150..409 CDD:238113 100/273 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.