DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG4815

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:295 Identity:68/295 - (23%)
Similarity:106/295 - (35%) Gaps:81/295 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 HP--YCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMG 183
            ||  |.|...:...:||....||              .|:...|.|:.:..|.:||||||...:.
  Fly    32 HPRIYNGIKTTVESLGGVGIQLF--------------NGRKLVCSATLLTPRHILTAAHCFENLN 82

  Fly   184 RNLTAAILGE-----WNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLR 243
            |:....|.|:     |:       .|:.|..:     .|||.|     |.:|:::.:..|:|:.:
  Fly    83 RSKFHVIGGKSAEFTWH-------GNNFNKNK-----LIRVQI-----HPKYAKMKFIADVAVAK 130

  Fly   244 LSRPVNWLQMQNLEPVCLPPQRGRYAN--QLAGSAAD------VSGW---GKTESSGSSKIKQKA 297
            ...|:                |.:|..  ||..|...      .:||   |........|..:..
  Fly   131 TKYPL----------------RSKYIGYAQLCRSVLHPRDKLIAAGWGFEGGVWDESRKKTFRSM 179

  Fly   298 MLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVV 362
            .:.|..:..|::..  |.|  :..:.:|||.......|.|||||||.:.......|.:.:     
  Fly   180 KVGIVSKRDCEKQL--DRK--MPPNIICAGAYNNKTLCFGDSGGPLLLGRQVCGINTWTF----- 235

  Fly   363 SIGRKHCGTALFSGIYTRVSSYMDWIESTIRANRI 397
                 .||......:|..|..|..:|:.||  ||:
  Fly   236 -----KCGNNEKPDVYMGVRYYAKFIKRTI--NRM 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 59/272 (22%)
Tryp_SPc 133..391 CDD:238113 60/273 (22%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 58/270 (21%)
Trypsin 49..256 CDD:278516 57/267 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.