DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and grass

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:398 Identity:114/398 - (28%)
Similarity:177/398 - (44%) Gaps:83/398 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NCNSVEFGRGTCIEKKDCDFYAVDKLME--LASKQQCFSRQRPDLV-----------------CC 73
            :|.:.:..:|.|:....|      :.:|  |...|:...:...|..                 ||
  Fly    31 DCTTPDGDQGQCMPFSSC------RTIEERLTEAQKAGQKVPADYASYLQKALCGEFNGVRHFCC 89

  Fly    74 PRETNIIPPLAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNT 138
            |                :.|...::..:.|..             .|:..||:..|.|:..|:..
  Fly    90 P----------------SANIQHNSKVMSLFK-------------DENFDCGNFLSQRVSNGYEV 125

  Fly   139 GLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCE 203
            .|...||..||.|:.. |...:.||.:.|::|::||||||:|.:..:|....|||....|:.||.
  Fly   126 KLSSRPWMALLRYQQF-GESRFLCGGAMISERYILTAAHCVHGLQNDLYEIRLGEHRISTEEDCR 189

  Fly   204 NDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLP--PQRG 266
            .. ...::||||.:.|.|::.|.|.:|...:..:|||||:|:|.|.:  .::::|:|||  .:..
  Fly   190 QQ-GRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPF--QKHIKPICLPITDELK 251

  Fly   267 RYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIG 331
            ..|.|:  |...|:|||.||:..||.:..:|.:.:||:..|.:|:.:...:    ||:|.||...
  Fly   252 EKAEQI--STYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQAYRRAVPL----SQLCVGGGDL 310

  Fly   332 VDSCSGDSGGPLTVEANTASGNRYVYLA---------GVVSIGRKHCGTALFSGIYTRVSSYMDW 387
            .|||.|||||||...|.        ||.         |:||.|...||.....|:||.|..|:.|
  Fly   311 QDSCKGDSGGPLQAPAQ--------YLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQW 367

  Fly   388 IESTIRAN 395
            |..|:.:|
  Fly   368 ITDTMASN 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 9/63 (14%)
Tryp_SPc 131..388 CDD:214473 93/267 (35%)
Tryp_SPc 133..391 CDD:238113 94/268 (35%)
grassNP_651543.1 CLIP 32..90 CDD:197829 9/63 (14%)
Tryp_SPc 121..371 CDD:238113 94/267 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.