DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG16710

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:378 Identity:113/378 - (29%)
Similarity:164/378 - (43%) Gaps:76/378 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LMELASK--------QQCFSRQRPDLVCCPRETNIIPPLAPRISNGTTNATSSTTTL-------- 101
            ||.||..        ::|.|..|     |   |:::|.|.|.      |.|.:...:        
  Fly    19 LMYLAESEYPPCNLDEKCISLAR-----C---TSLLPFLKPH------NMTPAEKAVFEDRYCGY 69

  Fly   102 -----KLLPRTTPRPPSGIDQLPEHPYCGSAF-SFRLVGGHNTGLFEFPWTTLLEY--------- 151
                 :||.|.....|:....||....||... ::|:.||..|...|.||..|:.|         
  Fly    70 GPKGQELLDRVLICCPNMGHILPNTQICGPIMPAYRIFGGEETQPNELPWMALILYAHRSRSVWN 134

  Fly   152 -ETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPP 215
             ..||     .|..|.|..|::||||||:...|.:|....|||.|..::|||...:||...|||.
  Fly   135 ERLVS-----RCAGSLITNRYVLTAAHCLRITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPE 194

  Fly   216 HIRVTIDRILPHAQYSELNYR--NDIALLRLSRPVNWLQMQNLEPVCLP-------PQRGRYANQ 271
            |:.:.:|..:.|..|.....|  ||||||||..||.:  ...::|:|:.       |....:..|
  Fly   195 HLEIDVDLSIKHRHYMVFEERPYNDIALLRLKFPVRY--TAQIKPICVQLDYIFSNPSFSNHKLQ 257

  Fly   272 LAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITL-ADSQMCAGGEIGVDSC 335
            :|       |||.:...|.|.:..:|.::.:..|:|.   ..:..:.| .::.:|||...|.|:|
  Fly   258 IA-------GWGLSHKQGYSNVLLQAYVNGRNADECS---LSEPSLGLDKETHICAGNLGGNDTC 312

  Fly   336 SGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWI 388
            .||||||| :.........:|||||:.|.|...||..  ...||:.|.:::||
  Fly   313 KGDSGGPL-MAIMERGDEEFVYLAGITSYGYSQCGYG--PAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 7/28 (25%)
Tryp_SPc 131..388 CDD:214473 89/276 (32%)
Tryp_SPc 133..391 CDD:238113 90/276 (33%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 13/62 (21%)
Tryp_SPc 105..362 CDD:214473 89/276 (32%)
Tryp_SPc 106..362 CDD:238113 88/275 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.