DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG31219

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:295 Identity:106/295 - (35%)
Similarity:163/295 - (55%) Gaps:30/295 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PPSGIDQLPEHPYCGSAFS-FRLVGGHNTGLFEFPWTTLLEY-ETVSGGKDYACGASFIAQRWLL 173
            ||.| ::||....||.:.| :|:|||.......:||..:|.| .|.:......|..|.|..|::|
  Fly    68 PPPG-NRLPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVL 131

  Fly   174 TAAHCIHTMGRNLT--AAILGEWNRDTD----PDCENDLNGVRECAPPHIRVTIDRILPHAQYSE 232
            |:|||::.:.|:|:  :..|||.:...|    |||.:..|   :||.|::.:.:::|:.|..:|.
  Fly   132 TSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDN---QCALPNLEIKLEKIIVHGLFSS 193

  Fly   233 LNYRN---DIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIK 294
            ::.||   |||||||..||.:  ...:.|:|: |:.|.:|.    |..:::|||||.....|::.
  Fly   194 ISNRNIEYDIALLRLKMPVRY--RTGIMPICI-PKHGFFAK----SKLEIAGWGKTNEGQFSQVL 251

  Fly   295 QKAMLHIQPQDQCQEAF-YKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYL 358
            ....:..:....|...| |.|...:|   |:||||..|||:|.|||||||.|..:.:|    |||
  Fly   252 MHGFIRERSIAVCALRFPYLDLNQSL---QICAGGYDGVDTCQGDSGGPLMVTMDNSS----VYL 309

  Fly   359 AGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIR 393
            ||:.:.|.|:||.....|||||.|:::.||::.:|
  Fly   310 AGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVLR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 95/267 (36%)
Tryp_SPc 133..391 CDD:238113 96/268 (36%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 95/267 (36%)
Tryp_SPc 90..342 CDD:238113 96/268 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.