DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG8870

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:339 Identity:97/339 - (28%)
Similarity:149/339 - (43%) Gaps:73/339 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VCCPRETNIIPPLAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGG 135
            ||||:....:|                                       |..||.: ..:...|
  Fly    63 VCCPKWETYLP---------------------------------------HDTCGQS-RRKPTKG 87

  Fly   136 HNTGLFEFPWTTLLEYETVSGGKDY-------ACGASFIAQRWLLTAAHCIHTMGRNLTAAI--- 190
            ....|.||||..:|.|    |.|:.       .||.|.|...::||||||:.....:...|:   
  Fly    88 KIPALNEFPWMAMLLY----GNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTV 148

  Fly   191 -LGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSE-LNYRNDIALLRLSRPVNWLQM 253
             |||.|..|:|| ...:||.|:.||.::.:.:|:|:.|.|::. ....|||||:||..||.:.:.
  Fly   149 RLGEHNTSTNPD-RAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRA 212

  Fly   254 QNLEPVCLPPQRGRYANQLAGSAA--DVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTK 316
              ::|:|||     .|.:||....  ..|||.......:|::..::.:..:..|.|:..:  |..
  Fly   213 --IQPICLP-----RAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPDVCKSNY--DFN 268

  Fly   317 ITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFS-GIYTR 380
            :   .||:||||..|.|:..||||||| :|..........|.||::|.|:|.|...... ..||:
  Fly   269 L---GSQICAGGLDGNDTSPGDSGGPL-METVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTK 329

  Fly   381 VSSYMDWIESTIRA 394
            .|.:.:||:|.:::
  Fly   330 TSYFFEWIKSKLQS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 2/2 (100%)
Tryp_SPc 131..388 CDD:214473 86/271 (32%)
Tryp_SPc 133..391 CDD:238113 88/272 (32%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 86/264 (33%)
Tryp_SPc 93..337 CDD:214473 84/261 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25969
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.