DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG11670

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:272 Identity:89/272 - (32%)
Similarity:129/272 - (47%) Gaps:46/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 EFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILG-----EWNRDTDPD 201
            ::|....|.:...:...||.||.|.|::.::||||||:.|.|.:.....:|     ||       
  Fly   180 QYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKEW------- 237

  Fly   202 CENDLNGVRECAPPHIRVTIDRILPHAQY-SELNYRNDIALLRLSRPV--NWLQMQNLEPVCLPP 263
               :||    .||...||.  :|..|..| :.||| :||.|::|:|||  .|.    :.||.|.|
  Fly   238 ---ELN----VAPQRRRVA--QIYLHPLYNASLNY-HDIGLIQLNRPVEYTWF----VRPVRLWP 288

  Fly   264 QRGRYANQLAGSAADVSGWGKTE-SSGSSKIKQKAMLHIQPQDQCQEAFYKD--TKITLADSQMC 325
            .     |.:........|:|.|. :...:.|..:..|.:.|.:||..:...|  :...|..||:|
  Fly   289 M-----NDIPYGKLHTMGYGSTGFAQPQTNILTELDLSVVPIEQCNSSLPADEGSPHGLLTSQIC 348

  Fly   326 AGG-EIGVDSCSGDSGGPLTV------EANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSS 383
            |.. |...|:|.|||||||.:      ..:|:..:...||.|:.|.| .:|.:.| .|:||||||
  Fly   349 AHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYG-AYCRSEL-PGVYTRVSS 411

  Fly   384 YMDWIESTIRAN 395
            |:|||.|.:..|
  Fly   412 YIDWIASIVWPN 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 85/263 (32%)
Tryp_SPc 133..391 CDD:238113 87/266 (33%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 87/266 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455931
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.