DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG12951

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:284 Identity:78/284 - (27%)
Similarity:117/284 - (41%) Gaps:77/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGR----------- 184
            |:|.|.::.:.::|:...|.    |....::||.|.|::.:::|||||  |.||           
  Fly    29 RVVNGTDSSVLKYPFVVSLR----SYDGSHSCGGSIISKHFVMTAAHC--TNGRPADTLSIQFGV 87

  Fly   185 -NLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYR-NDIALLRLSRP 247
             |::|  :|                      |:: |.|.:|:.|..:...... |||:||.:..|
  Fly    88 TNISA--MG----------------------PNV-VGIKKIIQHEDFDPTRQNANDISLLMVEEP 127

  Fly   248 VNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEA-- 310
            ..: ...::.||.||..........||....:.|||..::.||            .||..||.  
  Fly   128 FEF-DGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGS------------VQDTLQEVSL 179

  Fly   311 -FYKDTKITLADS-------QMCAG-GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGR 366
             .|.|.:.|...:       .:|.| .|.|...|||||||||......         .|:||...
  Fly   180 KIYSDEECTSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQ---------VGIVSWSI 235

  Fly   367 KHCGTALFSGIYTRVSSYMDWIES 390
            |.|..|.:.|:|.:||.|:|||:|
  Fly   236 KPCTVAPYPGVYCKVSQYVDWIKS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 75/280 (27%)
Tryp_SPc 133..391 CDD:238113 77/282 (27%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 75/280 (27%)
Tryp_SPc 30..260 CDD:238113 77/283 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455954
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.