DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and prss29

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001001228.1 Gene:prss29 / 407909 XenbaseID:XB-GENE-6453402 Length:330 Species:Xenopus tropicalis


Alignment Length:285 Identity:89/285 - (31%)
Similarity:135/285 - (47%) Gaps:41/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTM 182
            |....|.|...|.|:|||.::...|:||...||:|   ||  :.||.|.:...|:||||||..:|
 Frog    12 LHHQAYGGPVMSKRIVGGTDSEEGEWPWQISLEFE---GG--FLCGGSLLTDSWVLTAAHCFDSM 71

  Fly   183 GRNLTAAILGEWNRDTDPDCEND-LNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSR 246
            ..:...|.||.:...   |.:|. |.||:       .:|:     |..|.......||||:.|..
 Frog    72 NVSKYTAYLGVYQLS---DLDNAVLRGVK-------NITV-----HPDYMYEGSSGDIALIELEE 121

  Fly   247 PVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESS---GSSKIKQKAMLHIQPQDQCQ 308
            |:  :...:::|||||.|.   .....|:...|:|||..:.:   ...:..|||.:.:..:..|:
 Frog   122 PI--VFTPSIQPVCLPSQD---VPLPMGTMCWVTGWGNIKENTPLEDPQTLQKAEVGLINRTSCE 181

  Fly   309 EAF-----YKDTKITLADSQMCAGGEIG-VDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRK 367
            ..:     |:.:...:.|..:|||.:.| :|:|.|||||||.  .||:  |.::.. |:||.| .
 Frog   182 AMYQSSLGYRPSIHLIQDDMICAGYKQGKIDACQGDSGGPLV--CNTS--NTWLQF-GIVSWG-L 240

  Fly   368 HCGTALFSGIYTRVSSYMDWIESTI 392
            .|......|:||.|..|:.||:..:
 Frog   241 GCAEPNQPGVYTNVQYYLTWIQELV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 83/266 (31%)
Tryp_SPc 133..391 CDD:238113 84/267 (31%)
prss29NP_001001228.1 Tryp_SPc 26..263 CDD:238113 84/267 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.