DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG7542

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:306 Identity:82/306 - (26%)
Similarity:120/306 - (39%) Gaps:58/306 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 STTTLKLL----PRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGG 157
            |.|.:.||    |..|...|:.:.|.|..  .|...||    |:        |:|.         
  Fly    13 SCTAVPLLTDVEPYITNGEPAEVGQFPYQ--AGLNVSF----GN--------WSTW--------- 54

  Fly   158 KDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTID 222
                ||.:.|:..|::|||||:.  |.......||..|          :....|.....|.|...
  Fly    55 ----CGGTLISHYWIITAAHCMD--GAESVTVYLGAIN----------IGDESEEGQERIMVEKS 103

  Fly   223 RILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTES 287
            .|:.|:.|......|||:|:||...|.:  ...:....||.:............|..||||: ||
  Fly   104 GIIVHSNYMASTVVNDISLIRLPAFVGF--TDRIRAASLPRRLNGQFPTYESIRAFASGWGR-ES 165

  Fly   288 SGS---SKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANT 349
            ..|   |.:.:...:.|.|...|: .::..   .:::..:|.....|..:|.|||||||..:...
  Fly   166 DASDSVSPVLRYVEMPIMPHSLCR-MYWSG---AVSEKMICMSTTSGKSTCHGDSGGPLVYKQGN 226

  Fly   350 ASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIRAN 395
            :|     ||.|..|.|........|..::||:|||:|||.:.|.|:
  Fly   227 SS-----YLIGSTSFGTSMGCQVGFPAVFTRISSYLDWILNHIIAH 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 66/259 (25%)
Tryp_SPc 133..391 CDD:238113 68/260 (26%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 75/286 (26%)
Tryp_SPc 27..260 CDD:214473 73/283 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.