DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG4998

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:363 Identity:105/363 - (28%)
Similarity:157/363 - (43%) Gaps:100/363 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KQQCFSRQRP-------DLVCCPRETNIIPPLAPRISN------GTTNATSSTTTLKLLPRTTPR 110
            :|:.:...||       :.|||.|      ||.|:...      |..||...|..:|        
  Fly   884 EQRAYYGNRPVEKTCRINEVCCRR------PLRPQAPPQQFGRCGVRNAAGITGRIK-------- 934

  Fly   111 PPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPW-TTLLEYETVSGGKD-----YACGASFIAQ 169
            .|..:|                 |....|  |:|| ..:|:       ||     ||||.:.|..
  Fly   935 NPVYVD-----------------GDSEFG--EYPWHVAILK-------KDPKESIYACGGTLIDA 973

  Fly   170 RWLLTAAHCIHTMGRNLTAAILGEW--NRDTD--PDCENDLNGVRECAPPHIRVTIDRILPHAQY 230
            :.:::|||||.:.........||||  |.|.:  |..|.|:..|      ||         |.:|
  Fly   974 QHIISAAHCIKSQNGFDLRVRLGEWDVNHDVEFFPYIERDVVSV------HI---------HPEY 1023

  Fly   231 SELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKT---ESSGSSK 292
            ......||:|:|:|.:||::.:..::.|.|||   .:|:: ..|:....:||||.   |......
  Fly  1024 YAGTLDNDLAVLKLDQPVDFTKNPHISPACLP---DKYSD-FTGARCWTTGWGKDAFGEHGKYQN 1084

  Fly   293 IKQKAMLHIQPQDQCQEAFYKDTKI----TLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGN 353
            |.::..:.|....|| |:..::|::    .|....:|||||.|.|:|.||.||||..:.|.|   
  Fly  1085 ILKEVDVPILSHQQC-ESQLRNTRLGYSYKLNPGFVCAGGEEGKDACKGDGGGPLVCDRNGA--- 1145

  Fly   354 RYVYLAGVVS--IGRKHCGTALFSGIYTRVSSYMDWIE 389
              :::.||||  ||   ||.....|:|.:||:|:.||:
  Fly  1146 --MHVVGVVSWGIG---CGQVNVPGVYVKVSAYLPWIQ 1178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 5/21 (24%)
Tryp_SPc 131..388 CDD:214473 86/275 (31%)
Tryp_SPc 133..391 CDD:238113 88/276 (32%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 87/274 (32%)
Tryp_SPc 942..1177 CDD:214473 85/271 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455970
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.