DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and ovch1

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_956439.2 Gene:ovch1 / 393114 ZFINID:ZDB-GENE-040426-834 Length:556 Species:Danio rerio


Alignment Length:268 Identity:84/268 - (31%)
Similarity:130/268 - (48%) Gaps:41/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGR-NLTAAILGEW 194
            |::||.......:||...|:|..|.     .||.:.:.|.|::||.||.....: ::..|::|..
Zfish    56 RIIGGKEAWAHSWPWQVSLQYNDVP-----TCGGAILDQLWVITAGHCFKRYKKPSMWNAVVGLH 115

  Fly   195 NRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPV 259
            |.|      |.....||      .:.:.:|..|..|::....||||||:|..|:.:.:.  :.|:
Zfish   116 NLD------NANESSRE------SIQVQKIFSHKNYNQKTNENDIALLKLQSPLVFSKF--VRPI 166

  Fly   260 CLPPQRGRYANQLAG-SAADVSGWGKTESSG--SSKIKQKAMLHIQPQDQCQEAFYKDTKITLAD 321
                  |.:.|.|.. ....|:|||....:|  :|::::..:...:|| :|.. ||:.   .:..
Zfish   167 ------GVFNNDLPPLVTCTVTGWGSVTENGPQASRLQEVNVTVYEPQ-KCNR-FYRG---KVLK 220

  Fly   322 SQMCAG-GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYM 385
            |.:||| .|.|:|:|.|||||||    :...|.|| .||||||.| ..||.|...|:||.:..|.
Zfish   221 SMICAGANEGGMDACQGDSGGPL----SCFDGERY-KLAGVVSWG-VGCGRAQKPGVYTTLYHYR 279

  Fly   386 DWIESTIR 393
            .|:.|::|
Zfish   280 QWMVSSMR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 81/261 (31%)
Tryp_SPc 133..391 CDD:238113 81/262 (31%)
ovch1NP_956439.2 Tryp_SPc 56..281 CDD:214473 81/260 (31%)
Tryp_SPc 57..281 CDD:238113 80/259 (31%)
Tryp_SPc 331..551 CDD:238113
Tryp_SPc 331..549 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.