DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG18179

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:265 Identity:73/265 - (27%)
Similarity:107/265 - (40%) Gaps:50/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGA-SFIAQRWLLTAAHCIHT------MGRNLTA 188
            |:|.|:.....:.|:...|...| .|....|.|| :.||..|:||||||:.|      .|.|   
  Fly    39 RIVNGYPAPEGKAPYIVGLLIRT-DGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSN--- 99

  Fly   189 AILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQM 253
               ..||           ...|:      .|..|..:.|..:.....| ||.|:| :..|.:..:
  Fly   100 ---WGWN-----------GAFRQ------SVRRDNFISHPNWPAEGGR-DIGLIR-TPSVGFTDL 142

  Fly   254 QNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKIT 318
            .|  .|.| |.....:::...:.....|||..::...:...|...:.|....:|::::.     |
  Fly   143 IN--KVAL-PSFSEESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQSYG-----T 199

  Fly   319 LADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSS 383
            :|.:.||.....|..||.|||||||....|..       |.||::.|...|.:.. || ||||:.
  Fly   200 VASTDMCTRRTDGKSSCGGDSGGPLVTHDNAR-------LVGVITFGSVDCHSGP-SG-YTRVTD 255

  Fly   384 YMDWI 388
            |:.||
  Fly   256 YLGWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 71/263 (27%)
Tryp_SPc 133..391 CDD:238113 72/263 (27%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 71/263 (27%)
Tryp_SPc 40..263 CDD:238113 72/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.