DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG8329

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:254 Identity:64/254 - (25%)
Similarity:95/254 - (37%) Gaps:58/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 YETVSGGKDYAC----------GASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCEND 205
            |....|...||.          |.|.|...|:||||||:.|....:.......||          
  Fly    39 YPAYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHCLTTDSVTIHYGSNRAWN---------- 93

  Fly   206 LNGVRECAPPHIRVTIDR--ILPHAQYSELNYRNDIALLRLSRPVNWLQMQNL-EPVCLP--PQR 265
                     ..::.|:::  ...|..|.. :..:||.|:|    ..::...|| ..|.||  .|:
  Fly    94 ---------GQLQHTVNKNNFFRHPGYPN-SAGHDIGLIR----TPYVSFTNLINKVSLPKFSQK 144

  Fly   266 G-RYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGE 329
            | |:.|....:.    |||...:.|.:...|...:.:....:|..::.     ::|.:.||....
  Fly   145 GERFENWWCVAC----GWGGMANGGLADWLQCMDVQVISNGECARSYG-----SVASTDMCTRAT 200

  Fly   330 IGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWI 388
            .|...|.|||||.|....|...       .||::.....|.:.. || |||||.::|||
  Fly   201 DGKSVCGGDSGGALVTHDNPIQ-------VGVITFASIGCKSGP-SG-YTRVSDHLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 62/252 (25%)
Tryp_SPc 133..391 CDD:238113 64/254 (25%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 64/254 (25%)
Tryp_SPc 35..250 CDD:214473 62/252 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.